SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026916 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026916
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-28
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 103-257
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-25
Family Third domain of FERM 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026916   Gene: ENSMMUG00000020445   Transcript: ENSMMUT00000028764
Sequence length 419
Comment pep:known_by_projection chromosome:MMUL_1:4:164968154:164975478:-1 gene:ENSMMUG00000020445 transcript:ENSMMUT00000028764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHRARHLYYCHLKERVLRSQCAHREEAYFLLAACALQADLGDHREPAHTGRYFEPHSYFP
QWITTKRGIDYILRHMPALHRERQGLSPKEAVLCFIQEACRLEDVPVHFFRLHKDKKEGH
PTVILGLTLRGVHIYQEVDRAPQLLYDLPWPHIGKLAFLGKKLEIQLDGLPAAQKLVYYT
GCTWRSRHLLHLLRASHQLHLRVRPTLRQLRQREAAEEKQRYRESYISDGLELDPDSRGS
PGSGVSSQHCPHRLSRHSADSHGSSHTSGIEADSWLRESREMSVDTPLEVHGLHEKEPSS
SLRTSRSHPSICGDSQAIRQEPCAEVRTRGQSTEAVHQIWEMKAGVSEEPHSRSLDDTRR
HQLALHPAPTSPSRTFRCAPDCGLTAPCENRATLHSKRSSNCLTLDLFGEAPPPQEFVV
Download sequence
Identical sequences ENSMMUP00000026915 9544.ENSMMUP00000026916 ENSMMUP00000026916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]