SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026974 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026974
Domain Number 1 Region: 188-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.77e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0061
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 1.57e-26
Family Rieske iron-sulfur protein (ISP) 0.028
Further Details:      
 
Domain Number 3 Region: 506-584
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.12e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026974   Gene: ENSMMUG00000020478   Transcript: ENSMMUT00000028826
Sequence length 605
Comment pep:known chromosome:MMUL_1:10:64921927:64936161:-1 gene:ENSMMUG00000020478 transcript:ENSMMUT00000028826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLPTPHP
YPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKV
MAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSS
PRTLSCKGKEMENVFTIRTPEDANRVVRLARGRNVVIVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA
DVCVVGIGAVAATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEMNTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWL
TGKGS
Download sequence
Identical sequences A0A096NS76 A0A2K5MJI9 A0A2K5UFM5 A0A2K6E6X3
XP_002798330.1.72884 XP_005567958.1.63531 XP_011738068.1.29376 XP_011738069.1.29376 XP_011738070.1.29376 XP_011738071.1.29376 XP_011942739.1.92194 XP_011942740.1.92194 XP_015005271.1.72884 ENSMMUP00000026974 ENSMMUP00000026975 9544.ENSMMUP00000026974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]