SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026998 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026998
Domain Number 1 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.83e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 12-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 212-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 614-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-16
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 437-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000263
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 297-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000746
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026998   Gene: ENSMMUG00000020498   Transcript: ENSMMUT00000028852
Sequence length 658
Comment pep:novel chromosome:MMUL_1:19:63822050:63832087:1 gene:ENSMMUG00000020498 transcript:ENSMMUT00000028852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPGLRVSTDPEQVTFEDVVVDFSQEEWGQLKPAQRTLYRDVMLDTFRLLVSVGHWLPKP
NVISLLEQEAEPRAVDSGVPPGVYPDLETRPKVKLSVLKQGISEEISNSVILVERFLWDS
LWYCRDEDTEDHWEWSCESLESLAVPAAFTPVKTPVQEQWQRNGFGENVSLNPDLPHQPM
TPEKQGPHMWGTRGKREKPDLNVLQKTCVKEKPYKCQECRKAFSHSSALIEHHRTHTGER
PYECHECGKGFRNSSALTKHQRIHTGEKPYKCTQCGRTFNQIAPLIQHQRTHTGEKPYEC
SECGKSFSFRSSFSQHERTHTGEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCGECG
KAFSHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECSECGKAFS
QSTLLTEHRRIHTGEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECSQCGKAFRQSTH
LTQHQRIHTGEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQH
QRIHTGEKPYECNQCGRAFSQSSLLIEHQRIHTKEKPYGCNECGKSFSHSSSLSQHERTH
TGEKPYECHDCGKSFRQSTHLTQHRRIHTGEKPYVCRDCGKAFTHSSSLTKHQRTHTG
Download sequence
Identical sequences F6VIB6
ENSMMUP00000026997 XP_014980511.1.72884 9544.ENSMMUP00000026998 ENSMMUP00000026998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]