SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026999 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026999
Domain Number 1 Region: 398-489
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.88e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 267-438
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026999   Gene: ENSMMUG00000020502   Transcript: ENSMMUT00000028853
Sequence length 582
Comment pep:known chromosome:MMUL_1:6:110653085:110795889:1 gene:ENSMMUG00000020502 transcript:ENSMMUT00000028853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAAA
AASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNI
GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLS
TIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTW
TARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFN
TRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFL
SIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTK
RVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQAN
TLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQR
DFIEAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences 9544.ENSMMUP00000026999 ENSMMUP00000026999 ENSMMUP00000026999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]