SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027004 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027004
Domain Number 1 Region: 49-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-35
Family SCAN domain 0.0000523
Further Details:      
 
Domain Number 2 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 176-231
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 402-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 357-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000242
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027004   Gene: ENSMMUG00000020505   Transcript: ENSMMUT00000028858
Sequence length 548
Comment pep:known_by_projection chromosome:MMUL_1:19:63948250:63980469:1 gene:ENSMMUG00000020505 transcript:ENSMMUT00000028858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIEVVEVLTLNQEVAGPRNAQIQALYAEDGSLSPDAPSEEVQQQGKHPGDPEAARQRFR
QFRYKDMTGPREALDQLRQLCHQWLQPEARSKEQILELLVLEQFLGALPVKLRTWVESQH
PENCQEVVALVEGVTWISEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVTVLSEE
PVTFQDVAVDFSREEWGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPQ
EEPAPSLKVQESSRDCTLSSTLEDTLQGGVQEVQETVLKQVESAKEKDLPQKKHFDNHES
QANSGTLDTNQVSLQKIDSVESQVNNGALNTNQVLLQKIPPRKQLRKCDSQVKSMKHNSR
VKIHQKSYERQKAKEGNGCRKTFSRSAKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVH
KKIHTGERPYVCQACGKGFVQSSSLTQHQRVHSGERPFECHECGRTFNDRSAISQHLRTH
TGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTK
RKKKQPTS
Download sequence
Identical sequences A0A1D5QKY8
ENSMMUP00000027004 XP_005590643.1.63531 XP_005590644.1.63531 XP_011750044.1.29376 XP_011750045.1.29376 XP_014980517.1.72884 XP_014980518.1.72884 XP_014980519.1.72884 XP_014980520.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]