SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027082 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027082
Domain Number 1 Region: 181-249
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-16
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000015
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027082
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00304
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027082   Gene: ENSMMUG00000020567   Transcript: ENSMMUT00000028939
Sequence length 359
Comment pep:known_by_projection chromosome:MMUL_1:7:55323899:55329718:1 gene:ENSMMUG00000020567 transcript:ENSMMUT00000028939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGSRGLHLPDAGSGRQPAL
RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences A0A0D9RQB4 A0A2K5JS25 A0A2K5M8G6 A0A2K5V3G6 A0A2K6B824
ENSMMUP00000027082 ENSMMUP00000027082 9544.ENSMMUP00000027082 XP_001105068.1.72884 XP_005560211.1.63531 XP_008013955.1.81039 XP_011755384.1.29376 XP_011788214.1.43180 XP_011948869.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]