SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027378 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027378
Domain Number 1 Region: 84-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.96e-17
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 2 Region: 330-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 211-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 39-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000571
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 451-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000042
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 7-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000779
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027378   Gene: ENSMMUG00000020798   Transcript: ENSMMUT00000029260
Sequence length 499
Comment pep:known_by_projection chromosome:MMUL_1:19:46976077:47001727:1 gene:ENSMMUG00000020798 transcript:ENSMMUT00000029260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRAPALCSRALRELTRQLRCVCGPGFRAGPRATECLDVDECHRVPPPCDLGRCENTPG
SFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACENLPGSFRCVCPAGFRGSACEED
VDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCEN
TEGSFQCVCPTGFQPNAAGSECEDVDECENHLACPGQECVNSPGSFQCRPCPPGHHLHRG
RCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFP
HGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGH
RAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECR
NRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSF
LCVCPNSPEEFDPMTGRCV
Download sequence
Identical sequences ENSMMUP00000027378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]