SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027380 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027380
Domain Number 1 Region: 509-571
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 2 Region: 673-736
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 18-127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000127
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 85-197
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000126
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 210-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 865-948
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 376-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000427
Family EGF-type module 0.026
Further Details:      
 
Domain Number 8 Region: 616-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 577-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 331-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000208
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027380
Domain Number - Region: 423-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00847
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027380   Gene: ENSMMUG00000020798   Transcript: ENSMMUT00000029262
Sequence length 953
Comment pep:known_by_projection chromosome:MMUL_1:19:46980766:47001727:1 gene:ENSMMUG00000020798 transcript:ENSMMUT00000029262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPRAPALCSRALRELTRQLRCVCGPGFRAGPRATECLDVDECHRVPPPCDLGRCENTPG
SFLCVCPAGYQAAPHGASCQDVDECARSPPPCTYGRCENTEGSFQCVCPTGFQPNAAGSE
CEDVDECENHLACPGQECVNSPGSFQCRPCPPGHHLHRGRCTDVDECSSGAPPCGPHGHC
TNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGSFACTCAPGYRP
GPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDVDECRERGPA
LCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQRCENTPGSYRC
TPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVD
VNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVSPRTSAGTFPGSQPQAPA
SPVLPARPPPPPPPRRPSTPRQGPVGSGRRECYFDTAAPDACDNILARNVTWQECCCTVG
EGWGNGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDPSLRRDVDECQLFRDQVCKSGVCV
NTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDG
SQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCLYGEAWGMDCALCP
AQDSDDFEALCNVLRPPAYSPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYPPPALPYDP
YPPPPGPFARREAPYGAPRFDMPDFEDDGGPYGESEAPAPPGPGTRWPYRSRDTRRSFPE
PEELPEGGSYAGSLAEPYEELEAEECGILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMA
CVDINECDEAEAASPLCVNARCLNTDGSFRCICRPGFAPTHQPHHCAPARPRA
Download sequence
Identical sequences ENSMMUP00000027380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]