SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027449 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027449
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 252-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.42e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 532-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 364-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 588-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 644-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 308-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 476-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.99e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 686-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 213-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027449
Domain Number - Region: 186-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00639
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027449   Gene: ENSMMUG00000020859   Transcript: ENSMMUT00000029336
Sequence length 758
Comment pep:known chromosome:MMUL_1:10:58871659:58898054:-1 gene:ENSMMUG00000020859 transcript:ENSMMUT00000029336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRKTVMGPQGARRQAFLAFGDVTVDFTQKEWRLLNPAQRALYREVTLENYSHLVSLGI
LHSKPELIRRLEQGEAPWGEERRCRPGPRAGIYAEHVLRPKNLGLAHQRQQQLQFSDQSF
QSDTAEGQEKEKSSKPMAFSSPPLRHAVSSRRRNSVVEIESSQGQRENPTEIDKVLKGIE
NSRWGAFRCAERGQDLSQKTIVIIHKKAHSRQKLFTCRECHQGFRNESALLLHQKTHTGE
KSYVCSECGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKPYE
CQECGRRFNDKSSYNKHLKAHSGEKPFVCKECGRGYTNKSYFVVHKRIHSGEKPYRCQEC
GRGFSNKSHLITHQRTHSGEKPFACRQCEQSFSVKGSLLRHQRTHSGEKPFVCKDCERSF
SQKSTLIYHQRTHSGEKPFVCRECGQGFIQKSTLVKHQITHSEEKPFVCKDCGRGFIQKS
TFTLHQRTHSEEKPYGCRECGRRFRDKSSYNKHLRAHLGEKRFFCRDCGRGFTLKPNLTI
HQRTHSGEKPFMCKQCEKSFSLKANLLRHQWTHSGERPFNCKDCGRGFILKSTLLFHQKT
HSGEKPFICSECGQGFIWKSNLVKHQLAHSGKQPFVCKECGRGFNWKGNLLTHQRTHSGE
KPFVCNVCGQGFSWKRSLTRHHWRIHSKEKPFVCQECKRGYTSKSDLTVHERIHTGERPY
ECQECGRKFSNKSYYSKHLKRHLREKGFCTGSVGEASS
Download sequence
Identical sequences 9544.ENSMMUP00000027449 ENSMMUP00000027449 ENSMMUP00000027449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]