SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027592 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027592
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-40
Family SCAN domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 313-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 198-239
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000353
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027592   Gene: ENSMMUG00000020970   Transcript: ENSMMUT00000029489
Sequence length 459
Comment pep:known_by_projection chromosome:MMUL_1:20:3278384:3282483:1 gene:ENSMMUG00000020970 transcript:ENSMMUT00000029489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLEPQDQTSGEGEGLLIVKVEDSSWEQESAQHEDSRDSEACRQRFRQFCYGDVHGPH
EAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALV
EDLQKQPLKAWPQDVPSEEAEPEAAGQGSQAKGPPPMVGARRRPSVPQEQHSHSAQPPAL
LKEGRTRETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTL
GLGLKGQNEKSRLEEVVPVLPGQTGSDVTVSWSPEEAETWESENRPRAALGSVVGARRGR
PPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDL
VRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR
RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
Download sequence
Identical sequences A0A1D5QBI9
XP_014980934.1.72884 9544.ENSMMUP00000027592 ENSMMUP00000027592 ENSMMUP00000027592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]