SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027593 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027593
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily Caspase-like 1.39e-55
Family Caspase catalytic domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027593   Gene: ENSMMUG00000020971   Transcript: ENSMMUT00000029490
Sequence length 240
Comment pep:known_by_projection chromosome:MMUL_1:20:3285142:3290550:1 gene:ENSMMUG00000020971 transcript:ENSMMUT00000029490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGPNTQYDLSKTRAALLLAVIQGRPGAQHDVEALGGLCRALGFETTVRTDPTAQAFQEE
LAQFQKQLDTCRGPVSCVLVALMAHGGPQGQLLGADRQEVQPEALMQELSRCRVLWGRPK
VFLLQACRGGNRDAGVGPTALPWYWSWLRAPPSVPSHADVLQIYAEAQGYVAYRDDKGSD
FIQTLVEVLRANPGRDLLELLTEVNRRMCEQDVLGPDCDELRKACLEIRSSLRRRLCLQP
Download sequence
Identical sequences ENSMMUP00000027593 9544.ENSMMUP00000027593 ENSMMUP00000027593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]