SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027610 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027610
Domain Number 1 Region: 81-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.38e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.69e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027610   Gene: ENSMMUG00000017137   Transcript: ENSMMUT00000029507
Sequence length 222
Comment pep:known chromosome:MMUL_1:4:52433083:52440310:-1 gene:ENSMMUG00000017137 transcript:ENSMMUT00000029507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEIYLKSAEDLDKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPICPPEEKDAK
IALIKEKTKNRYFSAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDAKSLEEARKIFRF
Download sequence
Identical sequences A0A096NJ80 A0A0D9RKW0 A0A2K5M0G7 A0A2K6ADU0 C0SJM2 F7HKV9
NP_001182705.1.72884 XP_007970442.1.81039 XP_011836697.1.47321 XP_011836698.1.47321 XP_011925353.1.92194 ENSMMUP00000022540 ENSMMUP00000027610 ENSMMUP00000027612 ENSPANP00000013029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]