SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027702 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027702
Domain Number 1 Region: 136-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-59
Family SPRY domain 0.00000256
Further Details:      
 
Domain Number 2 Region: 51-124
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000177
Family RING finger domain, C3HC4 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027702   Gene: ENSMMUG00000021049   Transcript: ENSMMUT00000029601
Sequence length 333
Comment pep:novel chromosome:MMUL_1:11:108896289:108899896:1 gene:ENSMMUG00000021049 transcript:ENSMMUT00000029601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGVSGCHHGGWGNLANKRPSYAASPPYLSSWWKTMEYKGAFSRRVTTDELLKEATRCPI
CTAYLEKPMSLECECVFCLSCTKSLQKEPQGEGVLCPFCLVASQKNNIRLNRQLGSLVSH
IKELEPKLKKILKMNPRMRKCQVEVTLDVDTAHNLLLISEDLRSVRCGRIHQNRPNSAER
FNLAGAILGSPGFTSGRHYWEVDLGTSTEWNLGVCRESASRKGNIQMTTEHGFWIVSLRA
EGFHFANTSPPTPLWVNPNLQRMGIFMDRGMGDISFYHLGDGSHIYTFTKVFPEEPLRPY
FAPSTLPDQGVLSVCPVINPGTAHPLVHPGEGK
Download sequence
Identical sequences 9544.ENSMMUP00000027702 ENSMMUP00000027702 ENSMMUP00000027702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]