SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027847 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027847
Domain Number 1 Region: 107-165
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-24
Family KRAB domain (Kruppel-associated box) 0.00069
Further Details:      
 
Domain Number 2 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 580-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 357-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-20
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.72e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 711-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 637-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 400-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000308
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 749-791
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000259
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 544-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000113
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 12 Region: 450-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000398
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027847
Domain Number - Region: 203-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000445
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027847   Gene: ENSMMUG00000021154   Transcript: ENSMMUT00000029755
Sequence length 791
Comment pep:known_by_projection chromosome:MMUL_1:19:9336938:9372390:-1 gene:ENSMMUG00000021154 transcript:ENSMMUT00000029755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYFLTNCYQDLLIFEDTAVDFTQEEWTLLDPVQRNLYRDVMLENYENVAKVGFQLLKPS
VISWLEEEELRTLQQGVLQDRAMKHQTSVSALQQDFWKIQISNGIQTDLVTFDSVAVEFT
QEEWTLLDPTQRNLYRDVMLENYKNLSSVGYQLFKPSLISWLEEEEELSTLPRVLQEWKM
CLKTKGPALWQDNFCLKISNGIQLARNQNGEELYDCNQCGDVLYKHSCLKTNVSTHNREN
TSECIQYAKDLLSLYNKTSTIRKVSVFSKRGKSFSLILNVQVQRKCIQDKSFECIDYGKA
FVHQSHLEAHRKTQSGEKLYEWKQCGEAFTHSTSHAVNVETHIIKNSYECKECGKDFRYP
THLNNHVQTHIGIKPYKCKHCGKTFTVPSGFLEHVRTHTGEKPYGCKECGKAFGTSAGLI
EHIRCHAREKTFKCEHCGKAFISHPSLFGHLRVHNGEKPYEHKEYGKAFGTSSGVTEDRR
SNTGQKRFDCDQCGKVFVSFSSLFAHLRTHTGEKPFKCYKCGKPLTSSAYLRIHMQTHTE
ERLYQCKKCGKTFAKCSYLTKHLRTHTGEKPYECMKCGKAFTERSYLTKHLRRHSGEKPY
ECKKCGKAFTERSDLTKHLRRRHTGDKPYEYKECGKAFVVSSSLVDHLRTHTGYKPYKCN
ACEKAYSRSCVLTQHLKTHAAEKTSECNTCGKSFRNSLCFHDRLRTRTEIKPYKCKDCGK
VFTCHSDLTNHVRIHTGEKPYKCKECGKAFRTSSGRIQHLRTHMGEKSFECDQCGKAFAS
FSARIAHLKIH
Download sequence
Identical sequences F7H8Y3
ENSMMUP00000027847 ENSMMUP00000027847 9544.ENSMMUP00000027847 XP_014978269.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]