SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027914 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027914
Domain Number 1 Region: 895-1075
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 1050-1171
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.75e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 3 Region: 191-221,312-441
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 8.34e-20
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027914
Domain Number - Region: 436-497
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0732
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027914   Gene: ENSMMUG00000021197   Transcript: ENSMMUT00000029828
Sequence length 1301
Comment pep:known chromosome:MMUL_1:17:55729089:55938920:-1 gene:ENSMMUG00000021197 transcript:ENSMMUT00000029828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCIQDEPFPHPLEPEPGVSAQPGSGKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSAAHPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFLALIPSRVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQ
GEQRGVDPAEDLTDLEVVVPGSPGDCLPEEADGTDTHLGLPAVASQPALSSSRVCFPERI
LEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQ
VGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVI
QRHLSSLTDNEQADIFERVQKMKPAGDQEENELVILHLRQMCEARQKTHVHIGEGPSTIS
NSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLAS
EKDYSPGDSPPGTPPVSPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGR
AQGVRSPLLRQSSSEQCSTLSSVRRMYKESNSSSSLPSLHTSFSAPSFTAPSFLKSFYQN
SGRLSPQYENEIRQDVIRLFAFHSDGEGRKRTSSTCSNESLSVGGTSVTPRRISWRQRIF
LRVASPMNKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVIFLSGEDDPEKIEERKKSK
ELRSLWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQKEVLIIWDKKL
LNCRAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDVSYKELLK
QLTAQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGV
LLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENE
ISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESF
ENIVEFLKSTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACEDSE
PLEKLERANSQLKRQNMDLLEKLQVAHAKIQALESNLENILTRETKMKSLIRTLEQEKMA
YQKTVEQIRKLLPADALANCELLLRDLSCNPNNKAKIGSKP
Download sequence
Identical sequences ENSMMUP00000027914 9544.ENSMMUP00000027914 ENSMMUP00000027914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]