SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028099 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028099
Domain Number 1 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 265-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 640-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000717
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 224-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000139
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028099   Gene: ENSMMUG00000021333   Transcript: ENSMMUT00000030024
Sequence length 708
Comment pep:novel chromosome:MMUL_1:19:21844100:21854631:1 gene:ENSMMUG00000021333 transcript:ENSMMUT00000030024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVFQGPLTFMDVVIKFSPEEWQFLDTAQQNLYRDVMLENYRNLVFLGIGVPKPDLITCL
EQGKEPWNMKRHKMVAKPPGSEECVLYLVFLDLPVVVVLKQNLTLSLTSCFLFFFIVYLL
TNNSVCVSIFTFNRELSLYIHIYIKEFRSLLFTYKGSLVYWGAGRAVLEQGIKDSFPKVI
LRRYGKYGHDNLQLRKGCESVDECKMHKGGYDELKQCLITTRNKIFQCDKYVKVFHKFSS
SNSHNIRHTGNNSFKCKECGKSCCMLSHLTQHERTHTRVNRYKCKECGKAFSMPTSLNNH
KRIHTGEKPYKCEECGKAYNWPSIISKHKRIHTGKKPYKCEECGKAFSESSSLNNHKRIH
TGEKPYTCEECGKSYNWPSIISKHKRIHTGKKPYKCEECGKAFSESSSLNNHKRIHTGEK
PYKCEECGKAYNWPSTISKHKRIHTGKKPYKCEECGKAFSESSNLNSHKRIHTGEKPYKC
EECGKAFSESSSLNNHKRIHTGEKPYKCEECGKAFKIRAYLTTHNRIHTGEKPYKCKECG
KAFSGSSSLNNHKIIHSGEKPYKCEECGKAFKIRAYLTTHNRIHTGEKPYKCEECGKAFN
RSSSLTIHNRIHTVEKPYKCKQCGKGFSQSSSLTKHKIIHTTEKPYKCEECGKAFNKSSI
LNIHKMIHTKEKPQTLKESSNFFKYSSHLIVGKILYTRENYKCEECGK
Download sequence
Identical sequences ENSMMUP00000013187 9544.ENSMMUP00000028099 ENSMMUP00000028099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]