SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028103 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028103
Domain Number 1 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 238-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 184-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 559-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000615
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000119
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028103   Gene: ENSMMUG00000021333   Transcript: ENSMMUT00000030028
Sequence length 627
Comment pep:novel chromosome:MMUL_1:19:21844112:21854631:1 gene:ENSMMUG00000021333 transcript:ENSMMUT00000030028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTFMDVVIKFSPEEWQFLDTAQQNLYRDVMLENYRNLVFLGIGVPKPDLITCLEQGK
EPWNMKRHKMVAKPPVVYSHFAQDLWPEQGIKDSFPKVILRRYGKYGHDNLQLRKGCESV
DECKMHKGGYDELKQCLITTRNKIFQCDKYVKVFHKFSSSNSHNIRHTGNNSFKCKECGK
SCCMLSHLTQHERTHTRVNRYKCKECGKAFSMPTSLNNHKRIHTGEKPYKCEECGKAYNW
PSIISKHKRIHTGKKPYKCEECGKAFSESSSLNNHKRIHTGEKPYTCEECGKSYNWPSII
SKHKRIHTGKKPYKCEECGKAFSESSSLNNHKRIHTGEKPYKCEECGKAYNWPSTISKHK
RIHTGKKPYKCEECGKAFSESSNLNSHKRIHTGEKPYKCEECGKAFSESSSLNNHKRIHT
GEKPYKCEECGKAFKIRAYLTTHNRIHTGEKPYKCKECGKAFSGSSSLNNHKIIHSGEKP
YKCEECGKAFKIRAYLTTHNRIHTGEKPYKCEECGKAFNRSSSLTIHNRIHTVEKPYKCK
QCGKGFSQSSSLTKHKIIHTTEKPYKCEECGKAFNKSSILNIHKMIHTKEKPQTLKESSN
FFKYSSHLIVGKILYTRENYKCEECGK
Download sequence
Identical sequences ENSMMUP00000028103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]