SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028228 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028228
Domain Number 1 Region: 90-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.01e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 20-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000481
Family Glutathione S-transferase (GST), N-terminal domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028228   Gene: ENSMMUG00000021431   Transcript: ENSMMUT00000030164
Sequence length 234
Comment pep:known_by_projection chromosome:MMUL_1:15:1262173:1264088:1 gene:ENSMMUG00000021431 transcript:ENSMMUT00000030164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKLQLFVKASEDGEVGHCPSCQRLFMVLLLKGVPFTLTTVDTRSPDVLKDFAPGSQL
PILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPA
QDEALYQQLLRALARLDSYLRAPLEHELALEPQLRESRRRFLDGDRLTLADCSLLPKLHI
VDTVCAHFRQAPIPAGLPGVRRYLDSALQEKEFKYTCPHSAEILAAYRPAVHPR
Download sequence
Identical sequences ENSMMUP00000028228 ENSMMUP00000028228 9544.ENSMMUP00000028228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]