SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028279 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028279
Domain Number 1 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.08e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000979
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 134-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000137
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028279   Gene: ENSMMUG00000021466   Transcript: ENSMMUT00000030218
Sequence length 469
Comment pep:known_by_projection chromosome:MMUL_1:19:50443348:50446019:1 gene:ENSMMUG00000021466 transcript:ENSMMUT00000030218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVFFTEEELGLLDPAQRKLYQDVMLENFTNLLSVGYQPFHPFHFLREEKFWM
METATQREGSSGGRTVVEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQ
VEAELSIIHTGQKPSQNGKCKQSFSDVAIFDLPQQLHSGEKSHTCKECGKSFCYISALRI
HQRVHLREKLSKCDMRGKEFSQSSCLQTHERVYTGEKPFKCEQCGKAFRCRAILQVHCKL
HTGEKPYICEKCGRAFIHDFQLQKHQRIHTGEKPFKCEICGKCFCLRSSLNRHCMVHTAE
KLYKSEECGKAFIDRLDLHKHQMIHTGQKPYNCKECGKSFRWSSYLLIHQRIHSGEKPYR
CEECGKGYISKSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPFKCEDC
GKRLVHRSYCKDQQGDHNGENSSKCEDCGKRYKRRLNLDIILSLFLNDM
Download sequence
Identical sequences ENSMMUP00000028279 9544.ENSMMUP00000028279 ENSMMUP00000028279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]