SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028282 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028282
Domain Number 1 Region: 324-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 212-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 4 Region: 379-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-16
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 424-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000012
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028282   Gene: ENSMMUG00000021469   Transcript: ENSMMUT00000030221
Sequence length 487
Comment pep:known chromosome:MMUL_1:19:50492064:50501645:1 gene:ENSMMUG00000021469 transcript:ENSMMUT00000030221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMEQEAVTFKDVVVVFTEEELGLLDLAQRKLYRDVMLENFRNLLSVGHQPFHRDTFHFLR
EEKFWMMDIATQREGNSGGKIQPEMKTVPEAGPHEGLSCQQIWEEIASDLTRPQDSTTNS
SQFFEQGDAHSQVEEGLSIMHTGQKPSNHGKCKPSFSDVSIFDLPQQIHSAEKSHSRDEC
GKSFCYISALHIHQRVHLGEKLFKCDVCGKEFSQSLHLQTHQRVHTGEKPFKCEQCGRGF
RCRSALTVHCKLHMGEKHYNCEACGRAFIHDIQLQKHQRIHTGEKPFKCEICSMSFRLRS
SLNRHCVVHTGKKPNNTGEYGKGFIGRLDLCKHQTIHTGEKPYNCKECGKSFRRSSYLLI
HQRVHTGEKPYKCDKCGKSYITKSGLDLHHRAHTGERPYNCDDCGKSFRQASSILNHKRL
HCQKKPFKCEDCGKKLVHRSYRKKLVHRSDQPRDHSGENPSKCEDCGKRYKRRLNLDIIL
SLFLNDT
Download sequence
Identical sequences ENSMMUP00000028282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]