SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028283 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028283
Domain Number 1 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 2-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.83e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 183-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-19
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 6 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-16
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 8 Region: 514-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000728
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 147-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000124
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028283   Gene: ENSMMUG00000021470   Transcript: ENSMMUT00000030222
Sequence length 587
Comment pep:known_by_projection chromosome:MMUL_1:19:50517277:50523802:1 gene:ENSMMUG00000021470 transcript:ENSMMUT00000030222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVVFTEEELGLLDPAQKKLYRDVMLENFRNLLSVGHQLSYQDTFHFQREEKF
WIMETATQKEGNSGGKIQTELESVPETGPHEEWSCQQVWEQTASELTRPQDSMISSSQFS
TQGDVPSQVDAGLSIIHIGQTPSEDGKCKNFFSDVSILDLHQQLHSGKMSHTCNEYRKSF
CYSSALHQKVHMGKKLYKCDVCSKEFSQNSQLQTHQRIHTGEKPFKCEQCGKSFSRRSGM
YVHCKLHTGEKPHICEECGKAFIHNSQLREHQRIHTGEKPFKCYICGKSFHSRSNLNRHS
MVHMQEKSFRCDTCSNSFGQRSALNGHCRDHTGEKLYKCEECGRSFTCRQDLCKHQMDHT
GDKPYNCNICGKSFRWSSRLSRHQRIHSGEATFKCDGCGKRFHMNSRGHSHQTAHRGEKL
YKCQKCGKGYISKFNLDSHQRVHTGERPYNCKECGKSFRWASGILRHKRLHIGEKPFKCE
ECGKRFTENSKLRFHQRIHTGEKPYKCEECGKGFRWASTHLTHQRLHSREKVLQCEDCGK
SIVHSSCLQDQQRDHSGEKTSKCEDCGKRYKRRLNLDMILSLFLNDI
Download sequence
Identical sequences ENSMMUP00000028283 ENSMMUP00000028283 9544.ENSMMUP00000028283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]