SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028284 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028284
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 521-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-23
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 576-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 241-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 3-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 633-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000141
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 151-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000262
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028284   Gene: ENSMMUG00000021472   Transcript: ENSMMUT00000030224
Sequence length 706
Comment pep:known chromosome:MMUL_1:19:50530879:50564342:1 gene:ENSMMUG00000021472 transcript:ENSMMUT00000030224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTLKEAVTFKDVAVVFSEEELRLLDLAQRKLYREVMLENFRNLLSVGHQPLHRDTFHFL
KEEKFWMMETVTQREGNLGDKIQTEMETVPEVGTHEGLFSHQNCEQISSDLTRFQDSMVN
SFQFSKQDDMPCQVDAGLSIIHIRQKPSEGRKCKKFFSDVSILDLHQQLQSRDKSHTCDE
CGKSFCYSSALRIHQRVHMGEKLYNCDVCGKEFNQSSHLQIHQRIHTGEKPFKCEQCGKG
FSRRSGLYVHRKLHTGVKPHVCEKCGKAFIHDSQLQEHQRIHTGEKPFTCDTCCKSFRSR
ANLNRHSTVHMLEKPFRCDICGKSFGLKSALNSHRMVHTGEKRYKCEECGKRFIYRQDLY
KHQIDHTGEKPYNCKECGKSFRWASGLSRHVRVHSGETPFKCEECGKGFYTNSQRYSHQR
AHSGEKPYRCEECGKGYKRRLDLDFHQRVHRGEKPYNCKECGKSFGWASCLLNHQRIHSG
EKPFKCEECGKRFTQNSQLYTHRRVHSGEKPFKCEECGKRFTQNSQLYSHRRVHTGVKPY
KCEECGKGFNSKFNLDMHQRVHTGERPYNCKECGKSFSRASSILNHKRLHGDEKPFKCEE
CGKRFTDKSQLHSHQRVHTGEKPYKCEKCGKGFRWASTLLTHQRLHRREKVLQCEDCGKS
IVHSSCLRDQQRDHREEKTSKCEDCGKRYKRRLNLDMLLSLFLNDT
Download sequence
Identical sequences F7E636
XP_002801320.1.72884 XP_014979687.1.72884 XP_014979688.1.72884 XP_014979689.1.72884 ENSMMUP00000028284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]