SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028286 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028286
Domain Number 1 Region: 482-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 426-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 566-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 370-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 611-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 271-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-19
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 9 Region: 230-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000115
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 148-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000158
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 528-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000142
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028286   Gene: ENSMMUG00000021474   Transcript: ENSMMUT00000030226
Sequence length 683
Comment pep:known_by_projection chromosome:MMUL_1:19:50362181:50371231:-1 gene:ENSMMUG00000021474 transcript:ENSMMUT00000030226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSKEPVTFKDVAVVFSEEELRLLNLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLE
REEKLWMMKMATQRDNSSGGKNLKEMETLQEVGLRYPSHEEFFCSQIWQQITRELTKYQD
SVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHHRVHTDEKPYKGEHCVKSFSWSPHL
QINQRANAGEKPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTDDAAYRRFSQRSHLHHHQ
RVPTGENPYKYEECGRNIGKSSHCQARLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHT
GKKPYKCEECGKSFSWRSRLQAHQRIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKP
YKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCD
ACGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGK
GFSRSSDLNVHCRIHTGEKPYKCEKCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSV
GSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYL
QAHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQ
RVHADDEGDKDFPSSEDSHRKTR
Download sequence
Identical sequences 9544.ENSMMUP00000028286 ENSMMUP00000028286 ENSMMUP00000028286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]