SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028378 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028378
Domain Number 1 Region: 209-406
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-61
Family Reprolysin-like 0.00000188
Further Details:      
 
Domain Number 2 Region: 425-500
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 7.07e-21
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028378   Gene: ENSMMUG00000021549   Transcript: ENSMMUT00000030325
Sequence length 918
Comment pep:known_by_projection chromosome:MMUL_1:6:153851132:153947633:-1 gene:ENSMMUG00000021549 transcript:ENSMMUT00000030325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGAGAARLCLLALALQLLRPRAAREPGWTRGSGEGSPKLQHELIIPQWKTPESPVREK
HPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTLKLEDHCFYHGTVR
ETELSSVTLSTCRGIRGLITVSSNLSYVIEPLPDSEGQHLIYRSEHLKPPPGNCGFRHSK
LSTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADYAEFQKNRRDQDATKHKLIEI
ANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQL
ITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHNFGMTHDSADC
CSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG
NGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQ
CDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLC
FEKVNVAGDTFGNCGKDMNGEHRKCNTRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNG
RQIQCRGTHVYRGPEEEGDMLDPGLVMTGTKCGYNHICFEGQCRNTSFFETEGCGKKCNG
HGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESVGPVVAGVLVAIFVLAVLMLM
YYCCRQNNKLGQLKPSALPSKLRQQFCCPFRVSQSSGTGHANPTFKLQTPQGKRKVINTP
EILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI
PPAPNCILSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRTPGAGPQHSRPLAAPAP
KFPEYRSQRAGGMISSKI
Download sequence
Identical sequences F7FAH0
ENSMMUP00000028378 ENSMMUP00000033795 XP_001105246.2.72884 9544.ENSMMUP00000028378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]