SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028462 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028462
Domain Number 1 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-23
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 310-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 31-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-17
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028462   Gene: ENSMMUG00000021607   Transcript: ENSMMUT00000030413
Sequence length 430
Comment pep:known_by_projection chromosome:MMUL_1:2:88225258:88238593:-1 gene:ENSMMUG00000021607 transcript:ENSMMUT00000030413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDFQMLNQLCRTIINPSVVFCFIYCSDQIGPVTFEDVAVLFTEAEWKRLNLEQRNLFKE
VMLENLRNLVSLESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCP
GDQPQPQCPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGTLVGFSSLFQRPPISSQGGNR
ILEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAFNQKSNLFRQKAVTAEKSSD
KRQSQVCGECGRGFSRKSQLIIHQRTHTGEKPYVCGECGRGFIVESVLRNHLSTHSGEKP
YVCSQCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCQ
VTVPLEEWSLHLTTSSCNCVLPLASMTLSCFIFLYISSLCCVLSYPTFRFYSEFSFQLYN
LRDSLTRSPS
Download sequence
Identical sequences ENSMMUP00000028462 ENSMMUP00000028462 9544.ENSMMUP00000028462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]