SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028539 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028539
Domain Number 1 Region: 97-158
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-27
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.24e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 737-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 456-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 418-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 783-835
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000815
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 10 Region: 230-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000745
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028539   Gene: ENSMMUG00000021673   Transcript: ENSMMUT00000030497
Sequence length 868
Comment pep:known chromosome:MMUL_1:19:62502827:62518339:1 gene:ENSMMUG00000021673 transcript:ENSMMUT00000030497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAASAGAREPTPLRGRGAPRTKPRAGRGPTTGTPATLALPARGRPRSRNGLATKGQRG
AATTGPGHRALPSRDTALPKERNQKLEAAGTGIEPKAMPQGLVTFGDVAVDFSQEEWEWL
NPNQRNLYRKVMLENYKNLASLGLCVSKPDVISSLEQGKEPWTVKRKMTRAWCPDLKIVR
KIKELPLKKDFCEGKLSQAVITERLTSYNLEYSLLGEHWDYDALFDTQPGLVTIKNLAVD
FPQQLHPAQKNFSKNGIWENHSDLGSAGQCVAKPDLVSLLQQEKEPWMVKQELTGSLLSG
QRSVRETQELFPKQDSYAEGETDRTSNTKLECSSFRENWDSDCVFGRKLAVGQETQFREE
PINHNKTLSKERERTYNKSGRWFHLDDSEEKVHNCDSIKNFQKSSVVIKQTGIYAGKKLF
KCNECKKTFTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARHQRCHTGKKPYECIE
CGKAFIQNTSLIRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYKCDVCHK
SFRYGSSLTVHQRIHTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQ
NIHLASHLRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCSKAFTQKAHL
AQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCIECGKAFGDNSSCTQHQ
RLHTGQRPYECIECGKAFKTKSSLICHRRSHTGEKPYECSACGKAFSHRQSLSVHQRIHS
GKKPYECKECRKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS
TCPSLPSTSNPVDLFPKFLWNPSSLPSP
Download sequence
Identical sequences ENSMMUP00000028539 9544.ENSMMUP00000028539 XP_014980594.1.72884 ENSMMUP00000028539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]