SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028540 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028540
Domain Number 1 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 18-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.14e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 226-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.37e-18
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 10 Region: 348-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.86e-16
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028540   Gene: ENSMMUG00000021674   Transcript: ENSMMUT00000030498
Sequence length 671
Comment pep:known_by_projection chromosome:MMUL_1:19:62532902:62541278:1 gene:ENSMMUG00000021674 transcript:ENSMMUT00000030498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQEEVEVAGIKLRKAMSLGSVTFTDVAIDFSQDEWEWLNLAQRSLYKKVMLENYRNLV
SVGLCLSKPDVISLLEQEKDPWVIKGEMTRSLCPDLECVWVTKSLSLNQDIYEEKLPPAI
IMERLTSCDLECSTLGKNCKCEDLFERELVNQKTHFRQEIITHVDTLTEKRGHCNKSGTV
FHLNTLSYIKQIFPMEGRMFNFHTDKKSLKTHSVVKKHKQDCGEKKLLKCNDCEKIFSKI
STLTLHQRIHTGEKPYECIECGKAFSQSAHLAQHQRIHTGEKPFECIECGKAFSQNAHLV
QHQRVHTGEKPYQCKQCNKAFSQLAHLAQHQRVHTGEKPYECIECGKAFSDCSSLAHHRR
IHTGKRPYECIDCGKAFRQNASLIRHRRYYHTGEKPXXXXXXXEKPYECNTCEKAFSHRG
SLTLHQRVHTGEKPYECKECGKAFRQSTHLAHHQRIHTGEKPYECKECSKTFSQNAHLAQ
HQKIHTGEKPYECKECGKAFSQIAHLVQHQRVHTGEKPYECIECGKAFSDGSYLVQHQRL
HTGKRPYECLECGKAFRQRASLICHQRCHTGEKPYECNVCGKAFSHRKSLTLHQRIHTGE
KPYECKECSKAFSQVAHLTLHKRIHTGERPYECKECGKAFRQSVHLAHHQRIHTGESSVI
LSSALPYHQVL
Download sequence
Identical sequences 9544.ENSMMUP00000028540 ENSMMUP00000028540 ENSMMUP00000028540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]