SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028657 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028657
Domain Number 1 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 439-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 191-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000118
Family KRAB domain (Kruppel-associated box) 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028657
Domain Number - Region: 150-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.1
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028657   Gene: ENSMMUG00000021760   Transcript: ENSMMUT00000030619
Sequence length 498
Comment pep:known chromosome:MMUL_1:15:99135441:99155791:-1 gene:ENSMMUG00000021760 transcript:ENSMMUT00000030619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKEGVLPSPDPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQEGWRCLVSTPR
ERYKEGIPEKSRNLVLLGLPVSQPGMNSQLEQREGTWMLEGEDVRSPSPGWKIVSESPLE
QALSEKSFQDPHVEMPPGDSDHRTSELEKSFSLRPVLSPQQRVPVEARPRKRETHTKRFK
NSEITKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECNECGKAFSQSSSLIQHQ
RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHT
GEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKP
YRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCN
ECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGK
AFRCSSAFIRHQRLHAGE
Download sequence
Identical sequences ENSMMUP00000028657 ENSMMUP00000028657 XP_001095865.1.72884 XP_005582233.1.63531 9544.ENSMMUP00000028657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]