SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028682 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028682
Domain Number 1 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000969
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 2 Region: 158-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000583
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 118-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000523
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028682   Gene: ENSMMUG00000021782   Transcript: ENSMMUT00000030647
Sequence length 292
Comment pep:known_by_projection chromosome:MMUL_1:11:54195618:54217603:1 gene:ENSMMUG00000021782 transcript:ENSMMUT00000030647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADSKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDNAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Download sequence
Identical sequences A0A2K5KFG6 A0A2K5P495 A0A2K5X481 A0A2K5ZWR4 A0A2K6KXS1 F7DEG8
ENSMMUP00000028682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]