SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028749 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028749
Domain Number 1 Region: 145-334
Classification Level Classification E-value
Superfamily E set domains 1.26e-53
Family Cytoplasmic domain of inward rectifier potassium channel 0.00024
Further Details:      
 
Domain Number 2 Region: 36-186
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.54e-25
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028749   Gene: ENSMMUG00000021831   Transcript: ENSMMUT00000030719
Sequence length 360
Comment pep:known_by_projection chromosome:MMUL_1:12:96656579:96666919:-1 gene:ENSMMUG00000021831 transcript:ENSMMUT00000030719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSNCKVIAPLLSQRYQRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVLHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
IDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSEECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIRINGQSIDNFQISETGLTE
Download sequence
Identical sequences A0A2K6DS75
ENSMMUP00000028749 XP_001114542.1.72884 XP_011726392.1.29376 XP_011726393.1.29376 9544.ENSMMUP00000028749 ENSMMUP00000028749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]