SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028931 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028931
Domain Number 1 Region: 332-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-65
Family SPRY domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 32-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-19
Family V set domains (antibody variable domain-like) 0.00025
Further Details:      
 
Domain Number 3 Region: 156-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000749
Family C1 set domains (antibody constant domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028931   Gene: ENSMMUG00000021971   Transcript: ENSMMUT00000030912
Sequence length 582
Comment pep:novel chromosome:MMUL_1:4:26479012:26487772:1 gene:ENSMMUG00000021971 transcript:ENSMMUT00000030912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASSLAFLLLNFRVCLLLVQLLTPCSAQFAVLGPHGPILAMVGEDVDLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYSDGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIQWS
NTKGQHIPSVKAPVVADGVGLYAVAASVIMRGSSGEGVSCIIRNSLLGLEKTASISITDP
FFRNAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIALSRETEREREMKEMGYAATKQ
EISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTANAILLVSEDQR
SVQRAEEPRDLPDNPERFEWRYCVLGRENFTSGRHFWEVEVGDRKEWHIGVCSKNVERKK
GWVKMTPENGYWTMGLTDGNKYRALTDPRTNLKLPEPPWKVGIFLDYETGDISFYNATDG
SHIYTFPHTSFSEPLYPVFRILTLEPTALTICPTPKQVESSPDPGLVPDHSLETPVAPDL
ANESGEPQAEATSLLLPAHPGVDSPSTTTNQNHKQARTEALY
Download sequence
Identical sequences ENSMMUP00000028931 ENSMMUP00000028932 9544.ENSMMUP00000028931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]