SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028942 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028942
Domain Number 1 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 515-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 193-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000899
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 162-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000358
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028942   Gene: ENSMMUG00000028813   Transcript: ENSMMUT00000030923
Sequence length 566
Comment pep:novel chromosome:MMUL_1:19:22247332:22257454:-1 gene:ENSMMUG00000028813 transcript:ENSMMUT00000030923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTFMDVAIEFSVEEWQFLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQGK
EPWNMERHEMVAKPPGMCCYFAQDLWPEQSIKASFQRIIPRKYEKCGHHNLQLKKGCKSV
DEYKVHKGSYNGFNQCLSTTQSKIFQCDKYVRDFHKFSNSNRHKTEKNPFKCKECGKSFC
VLSHLTQHHKRIHTRQKHYKCEECGIAFNKSSHLNTHKIIHTREKSYKREECGKAFNISS
HLTKHKIIHTGENAYKCKECGKAFNQSSTLTRHKIIHAGEKPYICEHCGRAFNQSSNLTK
HKRIHTGDKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCEECGKAFNVSSTLTQHKRI
HTGEKPYKCEECGKAFNTSSHLTTHKRIHTGEKPYKCEECGKAFNQFSQLTTHKIIHTGE
KPYKCKECGKAFKRSSNLTEHRIIHTGEKPYKCEECGKAFNLSSHLTTHKKIHTGEKPYK
CKECGKAFNQSSTLARHKIIHAGEKPYKCEECGKAFYQYSNLTQHKIIHTGEKPYKCEEC
GKAFNWSSTLTKHKVIHTGQKPYKCK
Download sequence
Identical sequences ENSMMUP00000028942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]