SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028953 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028953
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.64e-39
Family Glutathione peroxidase-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028953   Gene: ENSMMUG00000021987   Transcript: ENSMMUT00000030934
Sequence length 144
Comment pep:known chromosome:MMUL_1:7:127938917:127942569:-1 gene:ENSMMUG00000021987 transcript:ENSMMUT00000030934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCE
VNGQNEHPVFAYLKDKLPYPHDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPF
RRYSRTFPTINIEPDIKRLLKVAI
Download sequence
Identical sequences 9544.ENSMMUP00000028953 ENSMMUP00000028953 ENSMMUP00000028953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]