SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029069 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029069
Domain Number 1 Region: 210-409
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.87e-62
Family Reprolysin-like 0.0000000112
Further Details:      
 
Domain Number 2 Region: 426-501
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.62e-22
Family Blood coagulation inhibitor (disintegrin) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029069   Gene: ENSMMUG00000022076   Transcript: ENSMMUT00000031058
Sequence length 812
Comment pep:known chromosome:MMUL_1:10:36998181:37011367:-1 gene:ENSMMUG00000022076 transcript:ENSMMUT00000031058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWRPGRARGSPFLLLLLLLLLWPVPGAGVLPGHIPGQSVTPYWVLDGRPWRAVSLEEPV
LKPDMGLVALEAEGQELLLELEKNHRLLAPGYIETHYAPDGRPVVLAPNHKDHCHYQGRV
RGFPNSWVVLCTCSGMSGLITLSSNASYYLRPWPPRGSKDFSTHKIFRMEQLFTWKGACG
HRDPGDKAGMASLPGAPQSRDRREARRTGRYLELYIVADHTLFLTQQRNLNHTKQRLLEV
ANYVDQLLRTLDIQVVLTGLEVWTERDRSRVTQDANATLWAFLQWRRRLWAQRPHDSTQL
LTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHSLGLSHDPDGC
CVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDSGLPVLPARC
GNGFVEAGEECDCGSGQECRDLCCFAHNCSLRPGAQCAHGDCCAHCLLKPAGALCRQAMG
DCDLPEFCTGISSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEA
CFQVVNSAGDAHGNCGQDSKGHFLPCAGRDVLCGKLQCQGGKPSLLTPHMVPVDSTVHLD
GHEVTCRGVLALPGAQLDLLGLGMVEPGTQCGPRMVCQSRRCENTAFQELHRCLTACHSH
GVCNSNHNCHCAPGWAPPFCDNPGFGGSTDSGPVQPENRDTFLLAMLLSVLLPLLPGAGL
AWCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHRDHPLGGVHPMELGPTATGQPWALGPE
NSHEPSSHPEKPPAVPPDPQADQVQMPRSCLW
Download sequence
Identical sequences ENSMMUP00000029069 9544.ENSMMUP00000029069 ENSMMUP00000037564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]