SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029201 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029201
Domain Number 1 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 170-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000262
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029201   Gene: ENSMMUG00000022185   Transcript: ENSMMUT00000031199
Sequence length 312
Comment pep:known chromosome:MMUL_1:8:101475900:101483512:1 gene:ENSMMUG00000022185 transcript:ENSMMUT00000031199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPN
VHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFAN
LAVAATQEDPPKMGDLTKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRH
FTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS
RTLAVHKTLHMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLR
RHSLTHTPRQDF
Download sequence
Identical sequences A0A2K5KAE0 A0A2K5P5I4 A0A2K5YW27 A0A2K6BB35 A0A2K6KVX4 A0A2K6QTX8 G1QQT4 G7MZU8 G7PCB0
9544.ENSMMUP00000029201 ENSMMUP00000029201 ENSNLEP00000003302 NP_001253929.1.72884 XP_003256090.1.23891 XP_005563838.1.63531 XP_010383916.1.97406 XP_011730026.1.29376 XP_011787201.1.43180 XP_011855404.1.47321 XP_011917019.1.92194 XP_017748269.1.44346 XP_017748342.1.44346 ENSMMUP00000029201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]