SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029259 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029259
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-35
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 229-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 761-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 678-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 976-1028
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 605-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000011
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 862-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000119
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 9 Region: 832-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000392
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 444-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000561
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 11 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000129
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029259   Gene: ENSMMUG00000022227   Transcript: ENSMMUT00000031265
Sequence length 1031
Comment pep:known chromosome:MMUL_1:2:92091574:92101466:1 gene:ENSMMUG00000022227 transcript:ENSMMUT00000031265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWHAVYPAQAQSSRERGRLQTIKKEEEDESYTPVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNP
ESGEEAVALLEELQRDLDGTSWRDPGPAQSPDVHWMGTGALRSAQIWSLASPLRSSSALG
DHLEPPYEIEARDFLAGQSDTPAAQMPALFQREGCPGDQVTPPRSLTAQLQPTMTFKDVE
VTFSQDEWGWLDSAQRNLYRDVMLENYRNMAFLVGPFTKPALISWLEAREPWGLNLQAAQ
PKGNAGVAPTGDDLQIKTNKFILDQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSR
QKDQCENPIQVTVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKH
FRMSSHHYDYKKYGKGLRHMIGGFSLHQRIHTGLKGNKKDVCGKDFSLSSHHQHGQSLHT
VGVSFKCSDCGRTFSHSSHLAYHQRLHTQEKAFKCRVCGKAFRWSSNCARHEKIHTGVKP
YKCDLCEKAFRRLSAYRLHRETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCS
QCRKSFHCKSYVLEHQRIHTQEKPYKCTKCRKTFRWRSNFTRHMRLHEEEKFYKQDECHE
GFRQSPDCSQPQGAPAVEKTFLCQQCGKTFTRKKTLVDHQRIHTGEKPYQCSDCGKDFAY
RSAFIVHKKKHAMKRKPEGGASFSQDRVFQVPQSSHSREEPYKCSQCGKAFRNHSFLLIH
QRVHTGEKPYKCRECGKAFRWSSNLYRHQRIHSLQKQYDCHESEKTPNVEPKILTGEKRF
WCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHSTERPFKCQW
CGKEFIGRHTLSSHQRKHTRAAQAERSPPARSSSQDTKLRLQKLKPSEEMPLEDCKEACN
QSSRLTGLQDITIGKKCHKCSICGKTFNKSSQLISHKRFHTRERPFKCTKCGKTFRWSSN
LARHMKNHIRD
Download sequence
Identical sequences 9544.ENSMMUP00000029259 ENSMMUP00000029259 ENSMMUP00000029259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]