SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029275 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029275
Domain Number 1 Region: 149-175,368-508
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.52e-43
Family Nuclear receptor ligand-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 95-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029275   Gene: ENSMMUG00000022240   Transcript: ENSMMUT00000031284
Sequence length 509
Comment pep:known chromosome:MMUL_1:2:166414782:166429160:1 gene:ENSMMUG00000022240 transcript:ENSMMUT00000031284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLSNIEG
ILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKG
FFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQ
RMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQDQLRPKPQLEQENIKSSSPPS
SDFAKEEVIGMVTRAHKDTFMYNQEQRENSAESMQPQRGERIPKNMEQYNLNHDHCGNGL
SSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQ
NENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPG
FRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNS
MFEFSEKLNALQLSDEEMSLFTAVVLVSA
Download sequence
Identical sequences ENSMMUP00000029275 9544.ENSMMUP00000029275 ENSMMUP00000029275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]