SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029352 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029352
Domain Number 1 Region: 107-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000808
Family Erythroid transcription factor GATA-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029352   Gene: ENSMMUG00000022298   Transcript: ENSMMUT00000031370
Sequence length 303
Comment pep:known scaffold:MMUL_1:1099214741702:60519:65607:-1 gene:ENSMMUG00000022298 transcript:ENSMMUT00000031370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPKPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTLLEIPP
PKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGAMSAATVLSREPYMCAQCKTDFT
CRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQGAAPAQ
AKAEPAAAPHPALKQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSER
TVSSGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPQSA
TWK
Download sequence
Identical sequences ENSMMUP00000029352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]