SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029601 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029601
Domain Number 1 Region: 292-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-43
Family SPRY domain 0.0002
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-23
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029601
Domain Number - Region: 120-161
Classification Level Classification E-value
Superfamily FAS1 domain 0.0051
Family FAS1 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029601   Gene: ENSMMUG00000022502   Transcript: ENSMMUT00000031641
Sequence length 494
Comment pep:known chromosome:MMUL_1:3:47164384:47190203:-1 gene:ENSMMUG00000022502 transcript:ENSMMUT00000031641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEDLQEELTCPICLEYFQDPVSIECGHNFCRGCLHRSWAPGGGPFPCPECRHPSAPAA
LRPNWALARLTEKTRRRRLGPVPPGLCSRHWEPLRLFCEDDQRPVCLVCRESQEHQTHAM
APIDEAFKSYRSDNFDIHRLIRLLLYHFKQEEKLLKSQRNLVSKMKKVMHLQDVEVKNAT
QWKDKIKSQRMRISTEFSKLHNFLVEEEDLFLQRLNKEEEESKKKLNENTLKLNQMIASL
KKLILEVGEKSQAPTLELLQNPKEVLTRSEIQDMNYSLEAVKVKTVCQIPLMKEMLKQFQ
VAVNLAEDTAHPKLVFSQEGRYVKNTASASSWPVFSTAWNYFAGWRNPQKTAYVERFQHL
PCVLGKNVFTSGKHYWEVERRDSLEVAVGVCREDVMGITDRSTMSPDVGIWAIYWSAAGY
WPLTGFPGTPTQQEPALHRVGVYLDRGTGNVSFYSAVDGVHLHTFACSSVSRLRPFFWLS
PLASLVIPPVTDRK
Download sequence
Identical sequences ENSMMUP00000029601 ENSMMUP00000029601 9544.ENSMMUP00000029601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]