SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029820 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000029820
Domain Number - Region: 234-372
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00394
Family Cytidylytransferase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029820   Gene: ENSMMUG00000022648   Transcript: ENSMMUT00000031871
Sequence length 422
Comment pep:known chromosome:MMUL_1:1:177410011:177417537:1 gene:ENSMMUG00000022648 transcript:ENSMMUT00000031871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQWRRRHCCFVKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPV
TYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVTGLENTLSANG
SIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLA
PGIQITRIFLLGLSIKLNGYLQRAILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVAT
YCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP
DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPN
EFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK
LH
Download sequence
Identical sequences A0A2K5UPM5 A0A2K6AMM0 F7FM56
9544.ENSMMUP00000029820 ENSMMUP00000029820 NP_001248501.1.72884 XP_005540347.1.63531 XP_011744767.1.29376 ENSMMUP00000029820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]