SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029914 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029914
Domain Number 1 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 269-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 8 Region: 531-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 167-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000441
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 135-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000375
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029914
Domain Number - Region: 103-149
Classification Level Classification E-value
Superfamily Methylamine dehydrogenase, L chain 0.0732
Family Methylamine dehydrogenase, L chain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029914   Gene: ENSMMUG00000022718   Transcript: ENSMMUT00000031971
Sequence length 585
Comment pep:known_by_projection chromosome:MMUL_1:19:20801189:20812534:1 gene:ENSMMUG00000022718 transcript:ENSMMUT00000031971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLTFTDVAVEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGITVSKPDLITCLEKEKE
PWNMKRYEMVDEPPVICSHFAEDFWPEQDIKDSFKKVTLRRYDKCGPENLQLRKGYKTVG
DCKLYKGDYNGLNQCLTPTQSKMYHCDIYVKVFYAFSNSDRYKTRLTGKKPFQCKKCDKS
FCMLSQLTQHKIIHIRENTYRCKKFGNAFNQSSTLTNHKRIYVGEKHYKCEECGKAFNHY
STLTNHKRVHTGEKPYKCKECGKAFSSISSTFTKHKIIHTEEKPYTCKECGKAFNRSSTL
TSHKRIHTGEKPYKCEECGKAFNWSSTLTKHKAIHTGEKPYKCEECGKAFNQSSRLTRHK
QIHTGEKPYKFEECGRVFTCSSTLTQDKKIHTGEKPYNCEECGKVFTCSSTLTRHKRIHT
EEKPYKCNECGKAFNRSSHLTSHRRIHTGEKPYKCEECGKAFKQSSNLNSHKKIHTGEKP
YKCEECGKAFILSSRLNQHKKIHTGEKPYKCEECGKAFNRSSRLTQHKKIHTGEKPYKCQ
QCDKAFTHSSNLSSHKKIHTGEKPYKCEECGKSFNRSSRLTQHKK
Download sequence
Identical sequences ENSMMUP00000029914 ENSMMUP00000029914 9544.ENSMMUP00000029914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]