SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030010 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030010
Domain Number 1 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 554-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 189-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000257
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030010   Gene: ENSMMUG00000022794   Transcript: ENSMMUT00000032074
Sequence length 622
Comment pep:known_by_projection chromosome:MMUL_1:19:43197000:43212851:1 gene:ENSMMUG00000022794 transcript:ENSMMUT00000032074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQGSVSFNDVTVDFTQEEWQHLDHAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLERG
EEPWTSFSGHTCLEENWKAEDFLLKFKEHQEKYSRSVVSINHKKLVKEKGNIYEKTFTLG
KNPVNSKNLPPEYDTHGRILKNVSELIISNLNPARKRLSEYNGYGKSFLSTKQETTHPEV
KSHNQSDRAFSHNEVLMQYQKTETPAQSFGYNDCEKSFLKRGGLMTHNRPYRGENPSVYN
KKRRVTNIEKKHTCNECGKSFCRKSVLILHQGIHSEEKPYQCHQCGNAFRRKSYLIDHQR
THTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECLQCRNAFRLKSHLIRHQRTHTG
EKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKPY
ICNECGKSFSQKTTLALHEKTHNEEKPYICSECGKSFRQKTTLVAHQRTHTGEKSYECPH
CGKAFRMKSYLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYICNECGKS
FRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHTGEKPYKCSECGKCFRQK
TNLIVHQRTHTGGADGLTGCLS
Download sequence
Identical sequences ENSMMUP00000031641 ENSMMUP00000030010 9544.ENSMMUP00000030010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]