SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030306 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030306
Domain Number 1 Region: 66-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.71e-52
Family Astacin 0.00013
Further Details:      
 
Domain Number 2 Region: 426-592
Classification Level Classification E-value
Superfamily TRAF domain-like 1.13e-34
Family MATH domain 0.0013
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-29
Family MAM domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030306
Domain Number - Region: 606-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000355
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030306   Gene: ENSMMUG00000023019   Transcript: ENSMMUT00000032391
Sequence length 701
Comment pep:known_by_projection chromosome:MMUL_1:18:25117604:25150640:1 gene:ENSMMUG00000023019 transcript:ENSMMUT00000032391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLWNLSWFLFLDALLMISGLAKRNSLNVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGENYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVIK
GSGCWSSVGNRRAGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDSVSDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNRLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPENDHS
NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
EYSTDNVDGNLTLVEEIKEIPIGSWQLYHVTLKVTKKFRVVFEGRKGSGTSLGGLSIDDI
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLTHVTNAGIYFHLI
SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTNNGSYFWDRPSKVG
AVAVFPNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQATP
TPSVQDLCSKTTCENDGVCTVRDGKAECRCRSGEDWWYMGERCEKRGSTRDTIVIAVSST
VAVFALMLIITLVSVYCTRKKYRERMSSNGPNLTLQNPHPF
Download sequence
Identical sequences ENSMMUP00000030306 ENSMMUP00000030306 9544.ENSMMUP00000030306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]