SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030410 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030410
Domain Number 1 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 292-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 495-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 201-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 240-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 538-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000155
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 416-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000457
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 332-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000066
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 160-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030410   Gene: ENSMMUG00000021333   Transcript: ENSMMUT00000032500
Sequence length 583
Comment pep:novel chromosome:MMUL_1:19:21844100:21854429:1 gene:ENSMMUG00000021333 transcript:ENSMMUT00000032500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVFQGPLTFMDVVIKFSPEEWQFLDTAQQNLYRDVMLENYRNLVFLGENNFNTQFFCRM
FFDFGKLCSKENNFKKIYIFIFSETESHSVTNNYDCFLHHYNNGKKFHFYFILSLPSFFC
FSIVICFRFTHRSQQTQSVTSKFVKYIHLSLQCLITTRNKIFQCDKYVKVFHKFSSSNSH
NIRHTGNNSFKCKECGKSCCMLSHLTQHERTHTRVNRYKCKECGKAFSMPTSLNNHKRIH
TGEKPYKCEECGKAYNWPSIISKHKRIHTGKKPYKCEECGKAFSESSSLNNHNKHKRIHT
GKKPYKCEECGKAFSESSSLNNHKRIHTGEKPYKCEECGKAYNWPSTISKHKRIHTGKKP
YKCEECGKAFSESSNLNSHKRIHTGEKPYKCEECGKAFSESSSLNNHKRIHTGEKPYKCE
ECGKAFKIRAYLTTHNRIHTGEKPYKCKECGKAFSGSSSLNNHKIIHSGEKPYKCEECGK
AFKIRAYLTTHNRIHTGEKPYKCEECGKAFNRSSSLTIHNRIHTVEKPYKCKQCGKGFSQ
SSSLTKHKIIHTTEKPYKCEECGKAFNKSSILNIHKMIHTKEK
Download sequence
Identical sequences ENSMMUP00000030410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]