SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030486 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030486
Domain Number 1 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 686-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 9 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 10 Region: 733-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 11 Region: 225-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000448
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 13 Region: 145-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000533
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030486   Gene: ENSMMUG00000015533   Transcript: ENSMMUT00000032579
Sequence length 805
Comment pep:known_by_projection chromosome:MMUL_1:19:21013050:21036552:-1 gene:ENSMMUG00000015533 transcript:ENSMMUT00000032579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTFMDVAIEFCLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEK
EPWEPMRRHEMVAKPSVMCSHVAQDFWPEQHIKHPFQKVTLRRYKNCGHKNVHLKKDCKS
VDECKVRRGGYNGFNQCLPATQSNIFLFDKCVKTFHEFSNSNRHKISHTERRLFKCKECD
KSFCMLSQLTQHKIIHTRVNFCKCEKYGKAFNWPSIITKCKRINTGEKPYTCEECGKVFN
WSSHLTTHKKIYTRYKLYKCEECGKAFNKSSILTTHKIIRTGKKFYKCKECAKAFNQSSN
LSEHKKIHPRERLYKCEECGKAFNWPSTLIKHKRIHTGEKPYTCEECGKAFNQFSNLTTH
KRIHTAEKFYKCTECGEAFSRSSNLTKHKKIHTEKKPYKCEECGKAFKWSSKLTEHKLTH
TGEKPYKCEECGKAFNWPSTLTKHNRIHTGEKPYKCEVCGKAFNQFSNLTTHKRIHTAEK
PYKCEECGKAFSRSSNLSKHRKIHIEKKPYKCEECGKAFKWSSKLTEHKITHSGEKPYKC
EECGKAFNHFSILTKHKRIHTGEKPYKCEECGKAFTQSSNLTTHKKIHTGEKFYKCEECG
KAFTQSSNLTTHKKIHTGGKPYKCEECGKAFNQFSTLTKHKIIHTEEKPYKCEKCGKAFK
WSSTLTKHKIIHTGEKPYKCEECGKAFKLSSTLSTHKIIHTGEKPYKCEKCGKAFNRSSN
LIEHKKIHTGKQPYKCEECGKAFNYSSHLNTHKRIHTKEQPYKCKECGKAFNQYSNLTTH
NKIHTGEKLYKPEDVTVILTTPQTF
Download sequence
Identical sequences ENSMMUP00000030486 9544.ENSMMUP00000030486 ENSMMUP00000030486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]