SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030823 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030823
Domain Number 1 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-26
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 648-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 144-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 9 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 690-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 12 Region: 102-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 13 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030823   Gene: ENSMMUG00000001436   Transcript: ENSMMUT00000032941
Sequence length 747
Comment pep:known chromosome:MMUL_1:19:59248249:59279052:-1 gene:ENSMMUG00000001436 transcript:ENSMMUT00000032941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLTLKDVAIEFSQEEWTYLDSAQKTLYRDVILENYRNLVSLEYLVPDSIISLLEQGKEP
WNVDSQEKIASGSGSEVLWIRDQHDRRAAGNKLIENQLGVIHTGEKPYKCKECGKCFTQN
SHLASHRRIHTGEKPYKCNECGKAFSVRSSLTTHQTIHTGEKPYKCNECGKVFRHNSYLA
KHRRIHTGEKPYKCNKCGKAFSMHSNLTKHQIIHTGEKPFKCNECVKVFTQYSHLANHQR
IHTGEKPYRCDECSKAFSVRSSLTTHQAIHTGEKPYKCNDCGKVFTQNSHLASHRGIHSG
AKPYKCGECGKAFSQTSQLARHWRVHTGEKPYKCNECGRAFSVHSSLTIHQTIHTGPKPY
KCNDCGKVFRHSSYLAVHQRIHTGEKPYKCNECGKAFSVHSNLATHQVIHTGEKPYKCNE
CGKVFTQNSHLANHRRIHTGEKPYRCNECGKAFRARSSLAIHQATHSGEKPYKCNECGKV
FTQNSHLTNHWRIHTGEKPYKCNECGKAFGVRSSLAIHLVIHTGEKPYKCHECGKVFRRN
SHLARHQLIHTGEKPYKCNECGKAFRAHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLA
NHQRIHTGVKPYMCNECGKAFTVYSSLTTHQVIHTGEKPYKCNECGKVFTQNSHLARHRR
VHTGDKPYKCSECGRAFSQTSKLARHQRVHTGEKPYECNQCGKAFSVRSSLTTHQAIHSG
KKPYKCNECGKVFTQNSHLARHRGIHT
Download sequence
Identical sequences ENSMMUP00000030823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]