SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031402 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031402
Domain Number 1 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 9-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 302-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 566-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 259-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 9 Region: 229-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000621
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031402
Domain Number - Region: 206-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00013
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 91-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000573
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 166-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.021
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031402   Gene: ENSMMUG00000006121   Transcript: ENSMMUT00000038307
Sequence length 627
Comment pep:known chromosome:MMUL_1:19:63340304:63354184:1 gene:ENSMMUG00000006121 transcript:ENSMMUT00000038307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALVNTPQGHVTFEDIAVYFSQEEWGLLDEAQRCLYHDVMLENFSLMASVGCLHGIE
TEEAPSEHTISAQGVSQARTPKPGPSIPNAHSCEMCILVMKDILYLTEHQGTLPWQKPYT
SAASGKWFSFGSNLQLHQNQDSGEKHVRKEESSAFLLNSCKIPLSDNLFPCKDVEKDFPT
ILGLLQHQTTHSREEYAHRSREIFQQRRYKCEQVFNEKVHVTEHQRVHTGEKAYKRREYG
KSLNSKYSFVEHQRTHNAEKPYVCSICGKSFLHKQTLVGHQQRIHTRERSYVCIECGKSL
SSKYSLVEHQRTHNGEKPYVCNVCGKSFRHKQTFVGHQQRIHTGERPYVCIECGKSFIHS
YDRIRHQRVHTGERAYQCSECGKSFIYKQSLLDHQRIHTGERPYECKECGKAFIHKKRLL
EHQRIHTGEKPYVCIICGKSFIRSSDYMRHQRIHTGERAYECSDCGKAFISKQTLLKHHK
IHTRERPYECSECGKGFYLEVKLLQHQRIHTREQLYDCNECGKVFSHQKRLLEHQKVHTG
EKPCECSECGKCFRHRTSLIQHQKVHSGERPYNCTACEKAFIYKNKLVEHQRIHTGEKPY
ECGKCGKAFNKRYSLVRHQKVHTTEEP
Download sequence
Identical sequences F7B052
ENSMMUP00000031402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]