SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031413 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031413
Domain Number 1 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 209-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 1-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 422-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000732
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031413   Gene: ENSMMUG00000000361   Transcript: ENSMMUT00000038314
Sequence length 480
Comment pep:novel chromosome:MMUL_1:19:62360093:62364817:1 gene:ENSMMUG00000000361 transcript:ENSMMUT00000038314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSVTFQDVAIDFSKEEWGFLNPAQRDLYTTVMLENYQNLVWLGKCLKPFIQHVLSVGLS
ISKSVISLLEKRKLPWIMGKEEIRVPLPGLLNSKNNYRLEGYYVRLCRKSYCLSLIFDHV
DQPSYYFNKHSYQYNLKNCSDTPGAEIKELSAKRAINEVLSQFDTVIKCTRNICKECGNV
YCHNTQLTLRKRNHTRKKCNQCLDCGKHFTRRSTLIQYQRIHTGERPYKCNECSKTFNQR
AHLTQHERIHMGEKPYKCKEGRKTFSQMTHLTQHQSTHTREKFHECSECGKAFSRSSALM
DHQRIHSGEKPYECKECGRAFTQSAQLIRHQKTHSGEKPYECSKCKKSFVRLSSLIEHWR
THTGEKPYQRKDCKKTFCRVMQLTLHRRVHTGEKPYECKQCGKAFSAHSSLVTHKRTHSG
EKPYKCKECGKAFSAHSSLVTHKRTHTGEKPYKCHACGKAFNTSSTLCQHNRIHTGEKPF
Download sequence
Identical sequences ENSMMUP00000031413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]