SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031477 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031477
Domain Number 1 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-26
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-25
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 158-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 633-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 11 Region: 111-158
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 12 Region: 735-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 13 Region: 2-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 14 Region: 484-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000472
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031477   Gene: ENSMMUG00000001436   Transcript: ENSMMUT00000038375
Sequence length 791
Comment pep:known chromosome:MMUL_1:19:59248156:59279046:-1 gene:ENSMMUG00000001436 transcript:ENSMMUT00000038375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLKDVAIEFSQEEWTYLDSAQKTLYRDVILENYRNLVSLAWDTVLEGRQTNRRDQHDRR
AAGNKLIENQLGSHLPELQQFQGEGKIYEYNQVEKSLNNRGKHYKCDECGHRRIHTGEKP
YKCNECGKAFRAHSKLTTHQVIHTGEKPYKCKECGKCFTQNSHLASHRRIHTGEKPYKCN
ECGKAFSVRSSLTTHQTIHTGEKPYKCNECGKVFRHSSYLAVHQRIHTGEKPYKCNECGK
AFSVHSNLATHQVIHTGEKPYKCNECGKVFTQNSHLANHRRIHTGEKPYRCNECGKAFSV
RSTLTTHMAIHTGDKPYKCNECGKVFTQNSHLVSHQRSHTKEKPYKCYECGKAFRTRSNL
TTHQVIHTGEKRYKCNECGKVFSRNSQLSQHRKIHTGEKPYKCNECGKVFTQNSHLARHR
GIHTGEKPYKCNECGKAFRARSSLAIHQATHSGEKPYKCNECGKVFTQNSHLTNHWRIHT
GEKPYKCNECGKAFGVRSSLAIHLVIHTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKP
YKCNECGKAFRAHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKPYMCN
ECGKAFTVYSSLTTHQVIHTGEKPYKCNECGKVFTQNSHLARHRVIHTGEKPYKCNECGK
VFTQNSHLARHRRVHTGDKPYKCSECGRAFSQTSKLARHQRVHTGEKPYECNQCGKAFSV
RSSLTTHQAIHSGKKPYKCNECGKVFTQNSHLARHRGIHTGDKPYKCSECGKAFSQTSKL
ERHQRVHTGEK
Download sequence
Identical sequences ENSMMUP00000031477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]