SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031577 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031577
Domain Number 1 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.34e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 577-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 618-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 241-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000334
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031577   Gene: ENSMMUG00000021473   Transcript: ENSMMUT00000038477
Sequence length 700
Comment pep:known chromosome:MMUL_1:19:50573502:50588485:1 gene:ENSMMUG00000021473 transcript:ENSMMUT00000038477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFKEGLTFKDVAVVFTEEELGLLDPVQRNLYRDVMLENFRNLLSVGHHPFKHDVFPLE
KEKKLGMMKTATQRKGKSADKIQSEMETVPEAGRHEELSWGQIWKQIACDLIKYEDSMIN
ISRFSKQGDLSCQVRAGLYTTHTGQKLYQCDKYKKSFTDVCNFDLHQQLHSGEKSHTCDE
CGKSFCYISALHIHQRVHMGEKCYKCDVCGKEFSQSSHLQTHQRVHTVEKPFKCVECGKG
FSRRSTLTVHCKLHSGEKPYNCEECGRAFIHASHLQEHQRIHTGEKPFKCDTCGKNFRRR
SALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKPYKCEECGKCFIQPSQFQ
AHQRIHTGEKPYVCKVCGKGFIYSSSFQAHQGVHTGEKPYKCNECGKSFRMKIHYQVHLV
VHTGEKPYKCEVCGKAFRQSSYLKIHLKAHSVQKPYKCEECGQGFNQSSRLQIHQLIHTG
EKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFSQASHLLTHQRVHSGEKPF
KCEECGKSFSRSAHLQAHQKVHTGEKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYTCGE
CGKHFSQASSLQLHQSVHTGEKPYKCDVCGKVFSRSSQLQYHRRVHTGEKPYKCEICGKR
FSWRSNLVSHHKIHAAGTLYENDENNKNIRELSEEGSSTR
Download sequence
Identical sequences F7E630
XP_001108376.2.72884 XP_014979691.1.72884 XP_014979692.1.72884 ENSMMUP00000031577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]